Lineage for d1q12d1 (1q12 D:236-370)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 375107Superfamily b.40.6: MOP-like [50331] (3 families) (S)
  5. 375191Family b.40.6.3: ABC-transporter additional domain [50338] (2 proteins)
    probably stems out from the biMOP domain
  6. 375205Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 375211Species Escherichia coli [TaxId:562] [101772] (3 PDB entries)
  8. 375215Domain d1q12d1: 1q12 D:236-370 [95535]
    Other proteins in same PDB: d1q12a2, d1q12b2, d1q12c2, d1q12d2
    complexed with atp

Details for d1q12d1

PDB Entry: 1q12 (more details), 2.6 Å

PDB Description: Crystal Structure of the ATP-bound E. coli MalK

SCOP Domain Sequences for d1q12d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q12d1 b.40.6.3 (D:236-370) Maltose transport protein MalK, C-terminal domain {Escherichia coli}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepg

SCOP Domain Coordinates for d1q12d1:

Click to download the PDB-style file with coordinates for d1q12d1.
(The format of our PDB-style files is described here.)

Timeline for d1q12d1: