Lineage for d1pz8b_ (1pz8 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2049732Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2049733Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2050810Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 2050811Protein Agrin [101641] (1 species)
    alternative splicing
  7. 2050812Species Chicken (Gallus gallus) [TaxId:9031] [101642] (4 PDB entries)
  8. 2050816Domain d1pz8b_: 1pz8 B: [95408]
    complexed with ca

Details for d1pz8b_

PDB Entry: 1pz8 (more details), 2.35 Å

PDB Description: Modulation of agrin function by alternative splicing and Ca2+ binding
PDB Compounds: (B:) Agrin

SCOPe Domain Sequences for d1pz8b_:

Sequence, based on SEQRES records: (download)

>d1pz8b_ b.29.1.4 (B:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
daeaiafdgrtymeyhnavtkshlsneipaekalqsnhfelsikteatqglilwsgkgle
rsdyialaivdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapi
tgssplgatqldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedal
nnptilhc

Sequence, based on observed residues (ATOM records): (download)

>d1pz8b_ b.29.1.4 (B:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]}
daeaiafdgrtymeyhnavtaekalqsnhfelsikteatqglilwsgkglersdyialai
vdgfvqmmydlgskpvvlrstvpintnhwthikayrvqregslqvgneapitgssplgat
qldtdgalwlggmerlsvahklpkaystgfigcirdvivdrqelhlvedalnnptilhc

SCOPe Domain Coordinates for d1pz8b_:

Click to download the PDB-style file with coordinates for d1pz8b_.
(The format of our PDB-style files is described here.)

Timeline for d1pz8b_: