SCOPe 2.02: Domain d1pxxa2: 1pxx A:33-73

Lineage for d1pxxa2 (1pxx A:33-73)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries)

8. Domain d1pxxa2: 1pxx A:33-73 [95308]
   Other proteins in same PDB: d1pxxa1, d1pxxb1, d1pxxc1, d1pxxd1
   complexed with bog, dif, hem, nag

Details for d1pxxa2

PDB Entry: 1pxx, 2.9 Å

PDB Description: crystal structure of diclofenac bound to the cyclooxygenase active site of cox-2

PDB Compounds: (A:) Prostaglandin G/H synthase 2

SCOPe Domain Sequences for d1pxxa2:

Sequence; same for both SEQRES and ATOM records:

>d1pxxa2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d1pxxa2:

• d1pxxa2 first appeared in SCOP 1.67
  
• d1pxxa2 appears in SCOPe 2.01
  
• d1pxxa2 appears in SCOPe 2.03
  
• d1pxxa2 appears in the current release, SCOPe 2.08