Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species) the rest of protein is heme-linked peroxidase, all-alpha fold |
Species Mouse (Mus musculus) [TaxId:10090] [57212] (8 PDB entries) |
Domain d1pxxa2: 1pxx A:33-73 [95308] Other proteins in same PDB: d1pxxa1, d1pxxb1, d1pxxc1, d1pxxd1 complexed with bog, dif, hem, nag |
PDB Entry: 1pxx (more details), 2.9 Å
SCOPe Domain Sequences for d1pxxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxxa2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe
Timeline for d1pxxa2: