Lineage for d1px8a1 (1px8 A:1-13,A:360-500)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135947Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1135948Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1136329Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
    interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain
  6. 1136353Protein Beta-D-xylosidase [101926] (2 species)
    glycosyl hydrolase family 39
  7. 1136379Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [101927] (2 PDB entries)
  8. 1136384Domain d1px8a1: 1px8 A:1-13,A:360-500 [95281]
    Other proteins in same PDB: d1px8a2, d1px8b2
    complexed with xyp

Details for d1px8a1

PDB Entry: 1px8 (more details), 2.4 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d1px8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px8a1 b.71.1.2 (A:1-13,A:360-500) Beta-D-xylosidase {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
mikvrvpdfsdkkXemlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrf
rdvfikrqlideehgnpwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnl
kfklgknavvlyelteridesstyiglddskingy

SCOPe Domain Coordinates for d1px8a1:

Click to download the PDB-style file with coordinates for d1px8a1.
(The format of our PDB-style files is described here.)

Timeline for d1px8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px8a2