Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.14: NagD-like [102317] (7 proteins) duplication: consists of two segment-swapped domains of this fold; this results in the insertion of a circularly permuted domain after strand 3, analogously to the Cof family |
Protein Hypothetical protein TM1742 [102318] (1 species) putative NagD protein |
Species Thermotoga maritima [TaxId:2336] [102319] (2 PDB entries) |
Domain d1pw5a_: 1pw5 A: [95199] structural genomics, complexed with ndg, so4 |
PDB Entry: 1pw5 (more details), 2.8 Å
SCOPe Domain Sequences for d1pw5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pw5a_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} mldkielfildmdgtfylddsllpgslefletlkeknkrfvfftnnsslgaqdyvrklrn mgvdvpddavvtsgeitaehmlkrfgrcrifllgtpqlkkvfeayghvideenpdfvvlg fdktltyerlkkacillrkgkfyiathpdincpskegpvpdagsimaaieastgrkpdli agkpnplvvdvisekfgvpkermamvgdrlytdvklgknagivsilvltgettpedlera etkpdfvfknlge
Timeline for d1pw5a_: