Lineage for d1pm7b_ (1pm7 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 381159Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 381160Superfamily b.82.1: RmlC-like cupins [51182] (12 families) (S)
  5. 381161Family b.82.1.1: dTDP-sugar isomerase [51183] (2 proteins)
  6. 381162Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (5 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 381166Species Mycobacterium tuberculosis [TaxId:1773] [101971] (2 PDB entries)
  8. 381169Domain d1pm7b_: 1pm7 B: [94896]
    complexed with act, gol

Details for d1pm7b_

PDB Entry: 1pm7 (more details), 2.2 Å

PDB Description: rmlc (dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase)structure from mycobacterium tuberculosis and inhibitor design. the apo structure.

SCOP Domain Sequences for d1pm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm7b_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis}
mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
rasgllprweqtqrfigem

SCOP Domain Coordinates for d1pm7b_:

Click to download the PDB-style file with coordinates for d1pm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1pm7b_: