Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins) |
Protein Siroheme synthase CysG, domain 1 [102163] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [102164] (3 PDB entries) |
Domain d1pjta1: 1pjt A:1-113 [94778] Other proteins in same PDB: d1pjta2, d1pjta3, d1pjtb2, d1pjtb3 complexed with po4, sah; mutant |
PDB Entry: 1pjt (more details), 2.8 Å
SCOPe Domain Sequences for d1pjta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pjta1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim
Timeline for d1pjta1: