SCOPe 2.07: Domain d1pjqa3: 1pjq A:114-215

Lineage for d1pjqa3 (1pjq A:114-215)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.37: Siroheme synthase middle domains-like [75614] (1 superfamily)
   2 domains: (1) alpha+beta, 2 layers; (2) 3/4-helical bundle, right-handed twist, left-handed superhelix

4. Superfamily e.37.1: Siroheme synthase middle domains-like [75615] (2 families)

5. Family e.37.1.1: Siroheme synthase middle domains-like [75616] (2 proteins)

6. Protein Siroheme synthase CysG, domains 2 and 3 [103403] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [103404] (5 PDB entries)

8. Domain d1pjqa3: 1pjq A:114-215 [94768]
   Other proteins in same PDB: d1pjqa1, d1pjqa2, d1pjqb1, d1pjqb2
   complexed with act, pge, sah

Details for d1pjqa3

PDB Entry: 1pjq, 2.21 Å

PDB Description: Structure and function of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis

PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d1pjqa3:

Sequence; same for both SEQRES and ATOM records:

>d1pjqa3 e.37.1.1 (A:114-215) Siroheme synthase CysG, domains 2 and 3 {Salmonella typhimurium [TaxId: 90371]}
psiidrsplmvavssggtspvlarllreklesllpqhlgqvaryagqlrarvkkqfatmg
errrfwekffvndrlaqslanadekavnatterlfsepldhr

Timeline for d1pjqa3:

• d1pjqa3 first appeared in SCOP 1.67
  
• d1pjqa3 appears in SCOPe 2.06
  
• d1pjqa3 appears in the current release, SCOPe 2.08