Lineage for d1pjqa2 (1pjq A:216-457)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519171Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2519172Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2519173Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2519353Protein Siroheme synthase CysG, domains 4 and 5 [102682] (2 species)
  7. 2519357Species Salmonella typhimurium [TaxId:90371] [102683] (5 PDB entries)
  8. 2519362Domain d1pjqa2: 1pjq A:216-457 [94767]
    Other proteins in same PDB: d1pjqa1, d1pjqa3, d1pjqb1, d1pjqb3
    complexed with act, pge, sah

Details for d1pjqa2

PDB Entry: 1pjq (more details), 2.21 Å

PDB Description: Structure and function of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis
PDB Compounds: (A:) Siroheme synthase

SCOPe Domain Sequences for d1pjqa2:

Sequence, based on SEQRES records: (download)

>d1pjqa2 c.90.1.1 (A:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkragyh
cvpqeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasg
csaysgiplthrdyaqsvrlvtghlktggeldwenlaaekqtlvfymglnqaatiqekli
afgmqadmpvalvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfs
nh

Sequence, based on observed residues (ATOM records): (download)

>d1pjqa2 c.90.1.1 (A:216-457) Siroheme synthase CysG, domains 4 and 5 {Salmonella typhimurium [TaxId: 90371]}
gevvlvgagpgdaglltlkglqqiqqadivvydrlvsddimnlvrrdadrvfvgkrhcvp
qeeinqillreaqkgkrvvrlkggdpfifgrggeeletlchagipfsvvpgitaasgcsa
ysgiplthrdyaqsvrlvtgeldwenlaaekqtlvfymglnqaatiqekliafgmqadmp
valvengtsvkqrvvhgvltqlgelaqqvespaliivgrvvalrdklnwfsnh

SCOPe Domain Coordinates for d1pjqa2:

Click to download the PDB-style file with coordinates for d1pjqa2.
(The format of our PDB-style files is described here.)

Timeline for d1pjqa2: