Lineage for d1pj5a2 (1pj5 A:4-219,A:339-427)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849379Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 2849603Protein N,N-dimethylglycine oxidase [102181] (1 species)
  7. 2849604Species Arthrobacter globiformis [TaxId:1665] [102182] (3 PDB entries)
  8. 2849605Domain d1pj5a2: 1pj5 A:4-219,A:339-427 [94743]
    Other proteins in same PDB: d1pj5a1, d1pj5a3, d1pj5a4
    complexed with act, fad, na

Details for d1pj5a2

PDB Entry: 1pj5 (more details), 1.61 Å

PDB Description: Crystal structure of dimethylglycine oxidase of Arthrobacter globiformis in complex with acetate
PDB Compounds: (A:) N,N-dimethylglycine oxidase

SCOPe Domain Sequences for d1pj5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]}
tpriviigagivgtnladelvtrgwnnitvldqgplnmpggstshapglvfqtnpsktma
sfakytvekllsltedgvscfnqvgglevattetrladlkrklgyaaawgiegrllspae
cqelyplldgenilgglhvpsdglasaaravqllikrtesagvtyrgsttvtgieqsggr
vtgvqtadgvipadivvscagfwgakigamigmavpXpdggpllgeskeldgfyvaeavw
vthsagvakamaellttgrsetdlgecditrfedvqltpeyvsetsqqnfveiydvlhpl
qprlsp

SCOPe Domain Coordinates for d1pj5a2:

Click to download the PDB-style file with coordinates for d1pj5a2.
(The format of our PDB-style files is described here.)

Timeline for d1pj5a2: