Lineage for d1pj4b1 (1pj4 B:1280-1573)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106264Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2106424Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 2106442Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
  8. 2106460Domain d1pj4b1: 1pj4 B:1280-1573 [94736]
    Other proteins in same PDB: d1pj4a2, d1pj4b2, d1pj4c2, d1pj4d2
    complexed with atp, fum, mlt, mn

Details for d1pj4b1

PDB Entry: 1pj4 (more details), 2.3 Å

PDB Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate malate, ATP, Mn++, and allosteric activator fumarate.
PDB Compounds: (B:) NAD-dependent malic enzyme, mitochondrial

SCOPe Domain Sequences for d1pj4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj4b1 c.2.1.7 (B:1280-1573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1pj4b1:

Click to download the PDB-style file with coordinates for d1pj4b1.
(The format of our PDB-style files is described here.)

Timeline for d1pj4b1: