Lineage for d1pd1a3 (1pd1 A:301-552)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 704292Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 704293Superfamily c.62.1: vWA-like [53300] (5 families) (S)
  5. 704408Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 proteins)
  6. 704414Protein Sec24 [82461] (1 species)
  7. 704415Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82462] (4 PDB entries)
  8. 704417Domain d1pd1a3: 1pd1 A:301-552 [94509]
    Other proteins in same PDB: d1pd1a1, d1pd1a2, d1pd1a4, d1pd1a5
    complexed with a snare peptide
    complexed with zn

Details for d1pd1a3

PDB Entry: 1pd1 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide containing the DxE cargo sorting signal of yeast Sys1 protein
PDB Compounds: (A:) protein transport protein SEC24

SCOP Domain Sequences for d1pd1a3:

Sequence, based on SEQRES records: (download)

>d1pd1a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlit
nfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqllscqd
sfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkf
stefakhismdf

Sequence, based on observed residues (ATOM records): (download)

>d1pd1a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldseninmmdiadleepnsmvvslkacrqnietlltkipqifqsnlitnfalgpalksay
hliggvggkiivvsgtlpnlgigklqrdsfyknftidcskvqitvdlflasedymdvasl
snlsrftagqthfypgfsgknpndivkfstefakhismdf

SCOP Domain Coordinates for d1pd1a3:

Click to download the PDB-style file with coordinates for d1pd1a3.
(The format of our PDB-style files is described here.)

Timeline for d1pd1a3: