SCOP 1.71: Domain d1pd1a3: 1pd1 A:301-552

Lineage for d1pd1a3 (1pd1 A:301-552)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (4 families)

5. Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 proteins)

6. Protein Sec24 [82461] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82462] (4 PDB entries)

8. Domain d1pd1a3: 1pd1 A:301-552 [94509]
   Other proteins in same PDB: d1pd1a1, d1pd1a2, d1pd1a4, d1pd1a5
   complexed with a snare peptide
   complexed with zn

Details for d1pd1a3

PDB Entry: 1pd1, 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide containing the DxE cargo sorting signal of yeast Sys1 protein

SCOP Domain Sequences for d1pd1a3:

Sequence, based on SEQRES records:

>d1pd1a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlit
nfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqllscqd
sfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkf
stefakhismdf

Sequence, based on observed residues (ATOM records):

>d1pd1a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae)}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldseninmmdiadleepnsmvvslkacrqnietlltkipqifqsnlitnfalgpalksay
hliggvggkiivvsgtlpnlgigklqrdsfyknftidcskvqitvdlflasedymdvasl
snlsrftagqthfypgfsgknpndivkfstefakhismdf

Timeline for d1pd1a3:

• d1pd1a3 first appeared in SCOP 1.67
  
• d1pd1a3 appears in SCOP 1.69
  
• d1pd1a3 appears in SCOP 1.73
  
• d1pd1a3 appears in the current release, SCOPe 2.08