Class b: All beta proteins [48724] (149 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.8: beta-sandwich domain of Sec23/24 [81995] (1 family) |
Family b.2.8.1: beta-sandwich domain of Sec23/24 [81996] (2 proteins) |
Protein Sec24 [81999] (1 species) includes the N-terminal tail |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82000] (4 PDB entries) |
Domain d1pd1a2: 1pd1 A:133-215,A:553-646 [94508] Other proteins in same PDB: d1pd1a1, d1pd1a3, d1pd1a4, d1pd1a5 complexed with a snare peptide complexed with zn |
PDB Entry: 1pd1 (more details), 2.6 Å
SCOP Domain Sequences for d1pd1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pd1a2 b.2.8.1 (A:133-215,A:553-646) Sec24 {Baker's yeast (Saccharomyces cerevisiae)} rpmnqlypidlltelpppitdltlpppplvippermlvpselsnaspdyirstlnavpkn ssllkksklpfglvirpyqhlydXcmetvmrargstglrmsrfyghffnrssdlcafstm prdqsylfevnvdesimadycyvqvavllslnnsqrririitlamptteslaevyasa
Timeline for d1pd1a2:
View in 3D Domains from same chain: (mouse over for more information) d1pd1a1, d1pd1a3, d1pd1a4, d1pd1a5 |