Lineage for d1pbya5 (1pby A:166-273)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674116Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 674448Superfamily b.61.4: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69298] (1 family) (S)
  5. 674449Family b.61.4.1: Quinohemoprotein amine dehydrogenase A chain, domain 3 [69299] (1 protein)
  6. 674450Protein Quinohemoprotein amine dehydrogenase A chain, domain 3 [69300] (2 species)
  7. 674451Species Paracoccus denitrificans [TaxId:266] [69301] (2 PDB entries)
  8. 674452Domain d1pbya5: 1pby A:166-273 [94421]
    Other proteins in same PDB: d1pbya1, d1pbya2, d1pbya3, d1pbya4, d1pbyb_, d1pbyc_
    complexed with hem, tbu, trw

Details for d1pbya5

PDB Entry: 1pby (more details), 1.7 Å

PDB Description: structure of the phenylhydrazine adduct of the quinohemoprotein amine dehydrogenase from paracoccus denitrificans at 1.7 a resolution
PDB Compounds: (A:) quinohemoprotein amine dehydrogenase 60 kDa subunit

SCOP Domain Sequences for d1pbya5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pbya5 b.61.4.1 (A:166-273) Quinohemoprotein amine dehydrogenase A chain, domain 3 {Paracoccus denitrificans [TaxId: 266]}
pdayaddasgayvlagrqpgrgdytgrlvlkkagedyevtmtldfadgsrsfsgtgrilg
agewratlsdgtvtirqifalqdgrfsgrwhdadsdviggrlaavkad

SCOP Domain Coordinates for d1pbya5:

Click to download the PDB-style file with coordinates for d1pbya5.
(The format of our PDB-style files is described here.)

Timeline for d1pbya5: