![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.7: Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68956] (1 protein) |
![]() | Protein Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 [68957] (2 species) duplication: tandem repeat of two cytochrome c-like domains |
![]() | Species Paracoccus denitrificans [TaxId:266] [68958] (2 PDB entries) |
![]() | Domain d1pbya1: 1pby A:1-85 [94417] Other proteins in same PDB: d1pbya3, d1pbya4, d1pbya5, d1pbyb_, d1pbyc_ |
PDB Entry: 1pby (more details), 1.7 Å
SCOP Domain Sequences for d1pbya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pbya1 a.3.1.7 (A:1-85) Quinohemoprotein amine dehydrogenase A chain, domains 1 and 2 {Paracoccus denitrificans [TaxId: 266]} vtgeevlqnacaachvqhedgrweridaarktpegwdmtvtrmmrnhgvalepeeraaiv rhlsdtrglslaeteerryilerep
Timeline for d1pbya1:
![]() Domains from same chain: (mouse over for more information) d1pbya2, d1pbya3, d1pbya4, d1pbya5 |