SCOPe 2.06: Domain d1p9ca_: 1p9c A:

Lineage for d1p9ca_ (1p9c A:)

1. Root: SCOPe 2.06

2. Class j: Peptides [58231] (133 folds)

3. Fold j.105: Ubiquitin interacting motif (UIM) [90302] (1 superfamily)

4. Superfamily j.105.1: Ubiquitin interacting motif (UIM) [90303] (1 family)

5. Family j.105.1.1: Ubiquitin interacting motif (UIM) [90304] (2 proteins)
   amphipathic helix

6. Protein 26s proteasome non-ATPase regulatory subunit 4 (s5a) [103756] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103757] (3 PDB entries)

8. Domain d1p9ca_: 1p9c A: [94386]

Details for d1p9ca_

PDB Entry: 1p9c

PDB Description: nmr solution structure of the c-terminal ubiquitin-interacting motif of the proteasome subunit s5a

PDB Compounds: (A:) 26S proteasome non-ATPase regulatory subunit 4

SCOPe Domain Sequences for d1p9ca_:

Sequence; same for both SEQRES and ATOM records:

>d1p9ca_ j.105.1.1 (A:) 26s proteasome non-ATPase regulatory subunit 4 (s5a) {Human (Homo sapiens) [TaxId: 9606]}
mtisqqefgrtglpdlssmteeeqiayamqmslqgaefgqaesad

Timeline for d1p9ca_:

• d1p9ca_ first appeared in SCOP 1.67
  
• d1p9ca_ appears in SCOPe 2.05
  
• d1p9ca_ appears in SCOPe 2.07
  
• d1p9ca_ appears in the current release, SCOPe 2.08