Lineage for d1p8cf_ (1p8c F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735103Fold a.152: AhpD-like [69117] (1 superfamily)
    multihelical; contains 4-helical bundle and 2-helical arm
  4. 2735104Superfamily a.152.1: AhpD-like [69118] (4 families) (S)
    probable biological unit contains six domains of this fold arranged with 32 symmetry
  5. 2735134Family a.152.1.2: CMD-like [101468] (2 proteins)
    Pfam PF02627; hexamer of single-domain subunits
  6. 2735146Protein Hypothetical protein TM1620 [101469] (1 species)
  7. 2735147Species Thermotoga maritima [TaxId:2336] [101470] (2 PDB entries)
    Uniprot Q9X1V5
  8. 2735159Domain d1p8cf_: 1p8c F: [94359]
    structural genomics; MCSG target APC4843

Details for d1p8cf_

PDB Entry: 1p8c (more details), 2.3 Å

PDB Description: Crystal structure of TM1620 (APC4843) from Thermotoga maritima
PDB Compounds: (F:) conserved hypothetical protein

SCOPe Domain Sequences for d1p8cf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8cf_ a.152.1.2 (F:) Hypothetical protein TM1620 {Thermotoga maritima [TaxId: 2336]}
eykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcdd
ciryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekng

SCOPe Domain Coordinates for d1p8cf_:

Click to download the PDB-style file with coordinates for d1p8cf_.
(The format of our PDB-style files is described here.)

Timeline for d1p8cf_: