Lineage for d1p5dx1 (1p5d X:9-154)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. 2910207Protein Phosphomannomutase/phosphoglucomutase, N-terminal domain [419008] (1 species)
  7. 2910208Species Pseudomonas aeruginosa [TaxId:287] [419480] (12 PDB entries)
  8. 2910210Domain d1p5dx1: 1p5d X:9-154 [94138]
    Other proteins in same PDB: d1p5dx2, d1p5dx3, d1p5dx4
    complexed with g1p, zn
    has additional insertions and/or extensions that are not grouped together

Details for d1p5dx1

PDB Entry: 1p5d (more details), 1.6 Å

PDB Description: enzyme-ligand complex of p. aeruginosa pmm/pgm
PDB Compounds: (X:) Phosphomannomutase

SCOPe Domain Sequences for d1p5dx1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p5dx1 c.84.1.1 (X:9-154) Phosphomannomutase/phosphoglucomutase, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
lpasifraydirgvvgdtltaetaywigraigseslargepcvavgrdgrlsgpelvkql
iqglvdcgcqvsdvgmvptpvlyyaanvlegksgvmltgshnppdyngfkivvagetlan
eqiqalreriekndlasgvgsveqvd

SCOPe Domain Coordinates for d1p5dx1:

Click to download the PDB-style file with coordinates for d1p5dx1.
(The format of our PDB-style files is described here.)

Timeline for d1p5dx1: