SCOPe 2.07: Domain d1p1zb_: 1p1z B:

Lineage for d1p1zb_ (1p1z B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1p1zb_: 1p1z B: [93905]
   Other proteins in same PDB: d1p1za1, d1p1za2, d1p1zd_

Details for d1p1zb_

PDB Entry: 1p1z, 3.26 Å

PDB Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1p1zb_:

Sequence, based on SEQRES records:

>d1p1zb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Sequence, based on observed residues (ATOM records):

>d1p1zb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemssfskdwsf
yilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1p1zb_:

• d1p1zb_ first appeared in SCOP 1.67
  
• d1p1zb_ appears in SCOPe 2.06
  
• d1p1zb_ appears in the current release, SCOPe 2.08