SCOPe 2.07: Domain d1p1za1: 1p1z A:182-274

Lineage for d1p1za1 (1p1z A:182-274)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d1p1za1: 1p1z A:182-274 [93903]
   Other proteins in same PDB: d1p1za2, d1p1zb_, d1p1zd_

Details for d1p1za1

PDB Entry: 1p1z, 3.26 Å

PDB Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb

PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1p1za1:

Sequence; same for both SEQRES and ATOM records:

>d1p1za1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

Timeline for d1p1za1:

• d1p1za1 first appeared in SCOP 1.67
  
• d1p1za1 appears in SCOPe 2.06
  
• d1p1za1 appears in the current release, SCOPe 2.08