Lineage for d1p1zb_ (1p1z B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1758823Protein beta2-microglobulin [88600] (5 species)
  7. 1759459Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
    Uniprot P01887
  8. 1759730Domain d1p1zb_: 1p1z B: [93905]
    Other proteins in same PDB: d1p1za1, d1p1za2, d1p1zd_

Details for d1p1zb_

PDB Entry: 1p1z (more details), 3.26 Å

PDB Description: x-ray crystal structure of the lectin-like natural killer cell receptor ly-49c bound to its mhc class i ligand h-2kb
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1p1zb_:

Sequence, based on SEQRES records: (download)

>d1p1zb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Sequence, based on observed residues (ATOM records): (download)

>d1p1zb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemssfskdwsf
yilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1p1zb_:

Click to download the PDB-style file with coordinates for d1p1zb_.
(The format of our PDB-style files is described here.)

Timeline for d1p1zb_: