Lineage for d1p1va_ (1p1v A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1110785Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 1110786Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 1110799Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 1110897Species Human (Homo sapiens) [TaxId:9606] [49333] (63 PDB entries)
  8. 1110922Domain d1p1va_: 1p1v A: [93900]
    complexed with so4, zn; mutant

Details for d1p1va_

PDB Entry: 1p1v (more details), 1.4 Å

PDB Description: crystal structure of fals-associated human copper-zinc superoxide dismutase (cuznsod) mutant d125h to 1.4a
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1p1va_:

Sequence, based on SEQRES records: (download)

>d1p1va_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekadhlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d1p1va_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekadhlgkktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1p1va_:

Click to download the PDB-style file with coordinates for d1p1va_.
(The format of our PDB-style files is described here.)

Timeline for d1p1va_: