Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Mycothiol synthase MshD [103175] (1 species) duplication: consists of two NAT domains swapped with the C-terminal strands with both domains binding acetyl-CoA; structural link with the other families |
Species Mycobacterium tuberculosis [TaxId:1773] [103176] (2 PDB entries) Rv0819 |
Domain d1ozpa_: 1ozp A: [93853] complexed with aco has additional subdomain(s) that are not in the common domain |
PDB Entry: 1ozp (more details), 1.7 Å
SCOPe Domain Sequences for d1ozpa_:
Sequence, based on SEQRES records: (download)
>d1ozpa_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} aldwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggpii gylnlspprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparata salglvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqgg wtavqlaerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdp aaqrrglgqmltsigivslarrlggrktldpavepavllyvesdnvaavrtyqslgftty svdtayal
>d1ozpa_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} aldwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggpii gylnlsppggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasal glvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwta vqlaerrgeawfdpdglilafgdgrllgfhwtkvhpdhpglgevyvlgvdpaaqrrglgq mltsigivslarrlvepavllyvesdnvaavrtyqslgfttysvdtayal
Timeline for d1ozpa_: