Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) contains a common phosphate-binding site |
Family c.24.1.3: Inosicase [63971] (1 protein) |
Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [63973] (9 PDB entries) Uniprot P31335 |
Domain d1oz0a1: 1oz0 A:4-200 [93776] Other proteins in same PDB: d1oz0a2, d1oz0b2 complexed with k, ms1, po4 |
PDB Entry: 1oz0 (more details), 2.5 Å
SCOPe Domain Sequences for d1oz0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oz0a1 c.24.1.3 (A:4-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Chicken (Gallus gallus) [TaxId: 9031]} rqqlallsvsekaglvefarslnalglgliasggtatalrdaglpvrdvsdltgfpemlg grvktlhpavhagilarnipednadmnkqdfslvrvvvcnlypfvktvsspgvtvpeave kidiggvallraaaknharvtvvcdpadyssvakemaaskdkdtsvetrrhlalkaftht aqydaaisdyfrkeysk
Timeline for d1oz0a1: