Lineage for d1oypa1 (1oyp A:1-151)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499246Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 499247Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families) (S)
  5. 499353Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (2 proteins)
  6. 499360Protein Ribonuclease PH, domain 1 [102758] (3 species)
  7. 499366Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)
  8. 499368Domain d1oypa1: 1oyp A:1-151 [93734]
    Other proteins in same PDB: d1oypa2, d1oypb2, d1oypc2, d1oypd2, d1oype2, d1oypf2

Details for d1oypa1

PDB Entry: 1oyp (more details), 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

SCOP Domain Sequences for d1oypa1:

Sequence, based on SEQRES records: (download)

>d1oypa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

Sequence, based on observed residues (ATOM records): (download)

>d1oypa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlsgrtmeiqrligralravvdleklgertiwidcdviqadggtrtasitgaflam
aiaigklikagtik

SCOP Domain Coordinates for d1oypa1:

Click to download the PDB-style file with coordinates for d1oypa1.
(The format of our PDB-style files is described here.)

Timeline for d1oypa1: