SCOP 1.69: Domain d1oypf2: 1oyp F:152-243

Lineage for d1oypf2 (1oyp F:152-243)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (1 family)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (2 proteins)

6. Protein Ribonuclease PH, domain 2 [103150] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries)

8. Domain d1oypf2: 1oyp F:152-243 [93745]
   Other proteins in same PDB: d1oypa1, d1oypb1, d1oypc1, d1oypd1, d1oype1, d1oypf1

Details for d1oypf2

PDB Entry: 1oyp, 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

SCOP Domain Sequences for d1oypf2:

Sequence; same for both SEQRES and ATOM records:

>d1oypf2 d.101.1.1 (F:152-243) Ribonuclease PH, domain 2 {Bacillus subtilis}
tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs
redlngllglaekgiqelidkqkevlgdslpe

Timeline for d1oypf2:

• d1oypf2 first appeared in SCOP 1.67
  
• d1oypf2 appears in SCOP 1.71
  
• d1oypf2 appears in the current release, SCOPe 2.08