Lineage for d1oxkh_ (1oxk H:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1837703Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1837704Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 1837898Protein Response regulator Sin1 [102228] (1 species)
  7. 1837899Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102229] (2 PDB entries)
  8. 1837903Domain d1oxkh_: 1oxk H: [93697]
    Other proteins in same PDB: d1oxka_, d1oxkc_, d1oxke_, d1oxkg_, d1oxki_, d1oxkk_
    complexed with so4

Details for d1oxkh_

PDB Entry: 1oxk (more details), 2.1 Å

PDB Description: Complex between YPD1 and SLN1 response regulator domain in space group P3(2)
PDB Compounds: (H:) sln1

SCOPe Domain Sequences for d1oxkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oxkh_ c.23.1.1 (H:) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
svkilvvednhvnqevikrmlnlegienielacdgqeafdkvkeltskgenynmifmdvq
mpkvdgllstkmirrdlgytspivaltafaddsnikeclesgmngflskpikrpklktil
tefcaayq

SCOPe Domain Coordinates for d1oxkh_:

Click to download the PDB-style file with coordinates for d1oxkh_.
(The format of our PDB-style files is described here.)

Timeline for d1oxkh_: