SCOPe 2.05: Domain d1owrq2: 1owr Q:395-575

Lineage for d1owrq2 (1owr Q:395-575)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
   automatically mapped to Pfam PF00554

6. Protein T-cell transcription factor NFAT1 (NFATC), DNA-binding domain [49421] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49422] (9 PDB entries)

8. Domain d1owrq2: 1owr Q:395-575 [93664]
   Other proteins in same PDB: d1owrm1, d1owrn1, d1owrp1, d1owrq1
   protein/DNA complex

Details for d1owrq2

PDB Entry: 1owr, 3 Å

PDB Description: crystal structure of human nfat1 bound monomerically to dna

PDB Compounds: (Q:) Nuclear factor of activated T-cells, cytoplasmic 2

SCOPe Domain Sequences for d1owrq2:

Sequence; same for both SEQRES and ATOM records:

>d1owrq2 b.2.5.3 (Q:395-575) T-cell transcription factor NFAT1 (NFATC), DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
vplewplssqsgsyelrievqpkphhrahyetegsrgavkaptgghpvvqlhgymenkpl
glqifigtaderilkphafyqvhritgktvtttsyekivgntkvleiplepknnmratid
cagilklrnadielrkgetdigrkntrvrlvfrvhipessgrivslqtasnpiecsqrsa
h

Timeline for d1owrq2:

• d1owrq2 first appeared in SCOP 1.67
  
• d1owrq2 appears in SCOPe 2.04
  
• d1owrq2 appears in SCOPe 2.06
  
• d1owrq2 appears in the current release, SCOPe 2.08