Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein 2Fe-2S ferredoxin [54294] (17 species) |
Species Pseudomonas putida, putidaredoxin [TaxId:303] [54307] (13 PDB entries) |
Domain d1oqra_: 1oqr A: [93424] complexed with fes; mutant |
PDB Entry: 1oqr (more details), 1.65 Å
SCOPe Domain Sequences for d1oqra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} skvvyvshdgtrreldvadgvslmqaavsngiydivgdcggsascatchvyvneaftdkv paanereigmlesvtaelkpnsrlccqiimtpeldgivvdvpdrqw
Timeline for d1oqra_: