Lineage for d1ooix_ (1ooi X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2325006Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2325007Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2325020Protein Odorant binding protein LUSH [101190] (1 species)
  7. 2325021Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101191] (12 PDB entries)
  8. 2325038Domain d1ooix_: 1ooi X: [93385]

Details for d1ooix_

PDB Entry: 1ooi (more details), 2.04 Å

PDB Description: Crystal structure of LUSH from Drosophila melanogaster at pH 6.5
PDB Compounds: (X:) odorant binding protein LUSH

SCOPe Domain Sequences for d1ooix_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ooix_ a.39.2.1 (X:) Odorant binding protein LUSH {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mtmeqfltsldmirsgcapkfklktedldrlrvgdfnfppsqdlmcytkcvslmagtvnk
kgefnapkalaqlphlvppemmemsrksveacrdthkqfkescervyqtakcfsenadgq
fmwp

SCOPe Domain Coordinates for d1ooix_:

Click to download the PDB-style file with coordinates for d1ooix_.
(The format of our PDB-style files is described here.)

Timeline for d1ooix_: