Lineage for d1ojdf2 (1ojd F:290-401)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 500350Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 500351Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 500497Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins)
  6. 500517Protein Monoamine oxidase B [69673] (2 species)
  7. 500518Species Human (Homo sapiens) [TaxId:9606] [69674] (10 PDB entries)
  8. 500542Domain d1ojdf2: 1ojd F:290-401 [93119]
    Other proteins in same PDB: d1ojda1, d1ojdb1, d1ojdc1, d1ojdd1, d1ojde1, d1ojdf1, d1ojdg1, d1ojdh1, d1ojdi1, d1ojdl1

Details for d1ojdf2

PDB Entry: 1ojd (more details), 3.1 Å

PDB Description: human monoamine oxidase b in complex with lauryldimethylamine-n-oxide (ldao)

SCOP Domain Sequences for d1ojdf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojdf2 d.16.1.5 (F:290-401) Monoamine oxidase B {Human (Homo sapiens)}
plgsvikcivyykepfwrkkdycgtmiidgeeapvaytlddtkpegnyaaimgfilahka
rklarltkeerlkklcelyakvlgslealepvhyeeknwceeqysggcytty

SCOP Domain Coordinates for d1ojdf2:

Click to download the PDB-style file with coordinates for d1ojdf2.
(The format of our PDB-style files is described here.)

Timeline for d1ojdf2: