Lineage for d1ojdl1 (1ojd L:4-289,L:402-500)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 478897Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 478898Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 478952Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (13 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 479010Protein Monoamine oxidase B [69423] (2 species)
  7. 479011Species Human (Homo sapiens) [TaxId:9606] [69424] (10 PDB entries)
  8. 479039Domain d1ojdl1: 1ojd L:4-289,L:402-500 [93126]
    Other proteins in same PDB: d1ojda2, d1ojdb2, d1ojdc2, d1ojdd2, d1ojde2, d1ojdf2, d1ojdg2, d1ojdh2, d1ojdi2, d1ojdl2

Details for d1ojdl1

PDB Entry: 1ojd (more details), 3.1 Å

PDB Description: human monoamine oxidase b in complex with lauryldimethylamine-n-oxide (ldao)

SCOP Domain Sequences for d1ojdl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojdl1 c.3.1.2 (L:4-289,L:402-500) Monoamine oxidase B {Human (Homo sapiens)}
kcdvvvvgggisgmaaakllhdsglnvvvleardrvggrtytlrnqkvkyvdlggsyvgp
tqnrilrlakelgletykvneverlihhvkgksypfrgpfppvwnpityldhnnfwrtmd
dmgreipsdapwkaplaeewdnmtmkelldklcwtesakqlatlfvnlcvtaethevsal
wflwyvkqcggttriisttnggqerkfvggsgqvserimdllgdrvklerpviyidqtre
nvlvetlnhemyeakyvisaipptlgmkihfnpplpmmrnqmitrvXfppgiltqygrvl
rqpvdriyfagtetathwsgymegaveageraareilhamgkipedeiwqsepesvdvpa
qpitttflerhlpsvpgllrligltt

SCOP Domain Coordinates for d1ojdl1:

Click to download the PDB-style file with coordinates for d1ojdl1.
(The format of our PDB-style files is described here.)

Timeline for d1ojdl1: