SCOP 1.75: Domain d1oeyk_: 1oey K:

Lineage for d1oeyk_ (1oey K:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (10 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) [102792] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102793] (1 PDB entry)

8. Domain d1oeyk_: 1oey K: [92805]
   Other proteins in same PDB: d1oeya_, d1oeyb_, d1oeyc_, d1oeyd_

Details for d1oeyk_

PDB Entry: 1oey, 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase

PDB Compounds: (K:) neutrophil cytosol factor 4

SCOP Domain Sequences for d1oeyk_:

Sequence; same for both SEQRES and ATOM records:

>d1oeyk_ d.15.2.2 (K:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]}
mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv
rllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp

Timeline for d1oeyk_:

• d1oeyk_ first appeared in SCOP 1.67
  
• d1oeyk_ appears in SCOP 1.73
  
• d1oeyk_ appears in SCOPe 2.01
  
• d1oeyk_ appears in the current release, SCOPe 2.08