Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.2: CAD & PB1 domains [54277] (2 families) contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
Family d.15.2.2: PB1 domain [64225] (10 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
Protein Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) [102792] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [102793] (1 PDB entry) |
Domain d1oeyk_: 1oey K: [92805] Other proteins in same PDB: d1oeya_, d1oeyb_, d1oeyc_, d1oeyd_ |
PDB Entry: 1oey (more details), 2 Å
SCOP Domain Sequences for d1oeyk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oeyk_ d.15.2.2 (K:) Neutrophil cytosol factor 4 (p40phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} mtnwlrvyyyedtistikdiaveedlsstpllkdlleltrrefqredialnyrdaegdlv rllsdedvalmvrqarglpsqkrlfpwklhitqkdnyrvyntmp
Timeline for d1oeyk_: