SCOP 1.75: Domain d1oeya_: 1oey A:

Lineage for d1oeya_ (1oey A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.2: CAD & PB1 domains [54277] (2 families)
   contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily

5. Family d.15.2.2: PB1 domain [64225] (10 proteins)
   Pfam PF00564
   forms heterodimers, although not all PB1 domain pairs associate.

6. Protein Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) [102790] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102791] (1 PDB entry)

8. Domain d1oeya_: 1oey A: [92800]
   Other proteins in same PDB: d1oeyj_, d1oeyk_, d1oeyl_, d1oeym_

Details for d1oeya_

PDB Entry: 1oey, 2 Å

PDB Description: heterodimer of p40phox and p67phox pb1 domains from human nadph oxidase

PDB Compounds: (A:) neutrophil cytosol factor 2

SCOP Domain Sequences for d1oeya_:

Sequence; same for both SEQRES and ATOM records:

>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]}
gshmaytlkvhykytvvmktqpglpysqvrdmvskklelrlehtklsyrprdsnelvpls
edsmkdawgqvknycltlwcen

Timeline for d1oeya_:

• d1oeya_ first appeared in SCOP 1.67
  
• d1oeya_ appears in SCOP 1.73
  
• d1oeya_ appears in SCOPe 2.01
  
• d1oeya_ appears in the current release, SCOPe 2.08, called d1oeya1