SCOPe 2.02: Domain d1o7ct_: 1o7c T:

Lineage for d1o7ct_ (1o7c T:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.4: Link domain [56477] (3 proteins)

6. Protein TSG-6, Link module [56478] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56479] (3 PDB entries)

8. Domain d1o7ct_: 1o7c T: [92621]

Details for d1o7ct_

PDB Entry: 1o7c

PDB Description: solution structure of the human tsg-6 link module in the presence of a hyaluronan octasaccharide

PDB Compounds: (T:) tumor necrosis factor-inducible protein tsg-6

SCOPe Domain Sequences for d1o7ct_:

Sequence; same for both SEQRES and ATOM records:

>d1o7ct_ d.169.1.4 (T:) TSG-6, Link module {Human (Homo sapiens) [TaxId: 9606]}
gvyhrearsgkykltyaeakavcefegghlatykqleaarkigfhvcaagwmakgrvgyp
ivkpgpncgfgktgiidygirlnrserwdaycynphak

Timeline for d1o7ct_:

• d1o7ct_ first appeared in SCOP 1.67
  
• d1o7ct_ appears in SCOPe 2.01
  
• d1o7ct_ appears in SCOPe 2.03
  
• d1o7ct_ appears in the current release, SCOPe 2.08