Lineage for d1o4qa_ (1o4q A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1918721Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 1918722Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1918723Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1918740Protein c-src tyrosine kinase [55556] (3 species)
  7. 1918747Species Human (Homo sapiens) [TaxId:9606] [55557] (46 PDB entries)
  8. 1918758Domain d1o4qa_: 1o4q A: [92468]
    complexed with 256

Details for d1o4qa_

PDB Entry: 1o4q (more details), 1.7 Å

PDB Description: crystal structure of sh2 in complex with ru79256.
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1o4qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4qa_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcpt

SCOPe Domain Coordinates for d1o4qa_:

Click to download the PDB-style file with coordinates for d1o4qa_.
(The format of our PDB-style files is described here.)

Timeline for d1o4qa_: