Lineage for d1o4la_ (1o4l A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1035347Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1035348Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1035349Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1035366Protein c-src tyrosine kinase [55556] (3 species)
  7. 1035371Species Human (Homo sapiens) [TaxId:9606] [55557] (42 PDB entries)
  8. 1035386Domain d1o4la_: 1o4l A: [92463]
    complexed with cit

Details for d1o4la_

PDB Entry: 1o4l (more details), 1.65 Å

PDB Description: crystal structure of sh2 in complex with fragment2.
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d1o4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o4la_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
siqaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkh
ykirkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcp

SCOPe Domain Coordinates for d1o4la_:

Click to download the PDB-style file with coordinates for d1o4la_.
(The format of our PDB-style files is described here.)

Timeline for d1o4la_: