Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
Protein Transcriptional activator sigm54 (NtrC1), C-terminal domain [102389] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [102390] (2 PDB entries) |
Domain d1ny5a2: 1ny5 A:138-384 [92318] Other proteins in same PDB: d1ny5a1, d1ny5b1 inactive state complexed with adp, gol, mg, po4 |
PDB Entry: 1ny5 (more details), 2.4 Å
SCOPe Domain Sequences for d1ny5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva siprdifeaelfgyekgaftgavsskegffeladggtlfldeigelsleaqakllrvies gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr gelsclv
Timeline for d1ny5a2: