SCOP 1.67: Domain d1ntzk_: 1ntz K:

Lineage for d1ntzk_ (1ntz K:)

1. Root: SCOP 1.67

2. Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)

3. Fold f.23: Single transmembrane helix [81407] (30 superfamilies)
   not a true fold

4. Superfamily f.23.15: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81518] (1 family)

5. Family f.23.15.1: Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81517] (1 protein)

6. Protein Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81516] (1 species)
   the smallest subunit of the complex, interacts with subunit 10 and ISP, peripherally located

7. Species Cow (Bos taurus) [TaxId:9913] [81515] (9 PDB entries)

8. Domain d1ntzk_: 1ntz K: [92164]
   Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzb1, d1ntzb2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_
   complexed with fes, hem, uq2

Details for d1ntzk_

PDB Entry: 1ntz, 2.6 Å

PDB Description: Crystal Structure of Mitochondrial Cytochrome bc1 Complex Bound with Ubiquinone

SCOP Domain Sequences for d1ntzk_:

Sequence; same for both SEQRES and ATOM records:

>d1ntzk_ f.23.15.1 (K:) Subunit XI (6.4 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
mltrflgpryrqlarnwvptaqlwgavgavglvwatdwrlildwvpyingkfk

Timeline for d1ntzk_:

• d1ntzk_ is new in SCOP 1.67
  
• d1ntzk_ appears in SCOP 1.69
  
• d1ntzk_ appears in the current release, SCOPe 2.08