![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (4 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [56000] (9 PDB entries) |
![]() | Domain d1ntzb1: 1ntz B:17-235 [92151] Other proteins in same PDB: d1ntza1, d1ntza2, d1ntzc1, d1ntzc2, d1ntzd1, d1ntzd2, d1ntze1, d1ntze2, d1ntzf_, d1ntzg_, d1ntzh_, d1ntzi_, d1ntzj_, d1ntzk_ |
PDB Entry: 1ntz (more details), 2.6 Å
SCOP Domain Sequences for d1ntzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntzb1 d.185.1.1 (B:17-235) Cytochrome bc1 core subunit 2 {Cow (Bos taurus)} vpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlasslt tkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrwe vaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyvq nhftsarmaliglgvshpvlkqvaeqflnirgglglsga
Timeline for d1ntzb1: