![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins) N-terminal all-beta domain defines family |
![]() | Protein Alcohol dehydrogenase [51737] (9 species) |
![]() | Species Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries) |
![]() | Domain d1ntoc2: 1nto C:144-313 [92142] Other proteins in same PDB: d1ntoa1, d1ntob1, d1ntoc1, d1ntod1, d1ntoe1, d1ntoh1 complexed with zn; mutant |
PDB Entry: 1nto (more details), 1.94 Å
SCOPe Domain Sequences for d1ntoc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntoc2 c.2.1.1 (C:144-313) Alcohol dehydrogenase {Sulfolobus solfataricus [TaxId: 2287]} lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnysektlsvypkalak qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk
Timeline for d1ntoc2: