Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (16 proteins) N-terminal all-beta domain defines family |
Protein Alcohol dehydrogenase [51737] (9 species) |
Species Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries) |
Domain d1ntob2: 1nto B:144-313 [92140] Other proteins in same PDB: d1ntoa1, d1ntob1, d1ntoc1, d1ntod1, d1ntoe1, d1ntoh1 complexed with zn; mutant |
PDB Entry: 1nto (more details), 1.94 Å
SCOPe Domain Sequences for d1ntob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntob2 c.2.1.1 (B:144-313) Alcohol dehydrogenase {Sulfolobus solfataricus [TaxId: 2287]} lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnysektlsvypkalak qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk
Timeline for d1ntob2: