Lineage for d1ntob2 (1nto B:144-313)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387038Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins)
    N-terminal all-beta domain defines family
  6. 387056Protein Alcohol dehydrogenase [51737] (9 species)
  7. 387060Species Archaeon Sulfolobus solfataricus [TaxId:2287] [82286] (4 PDB entries)
  8. 387063Domain d1ntob2: 1nto B:144-313 [92140]
    Other proteins in same PDB: d1ntoa1, d1ntob1, d1ntoc1, d1ntod1, d1ntoe1, d1ntoh1

Details for d1ntob2

PDB Entry: 1nto (more details), 1.94 Å

PDB Description: n249y mutant of alcohol dehydrogenase from the archaeon sulfolobus solfataricus-monoclinic crystal form

SCOP Domain Sequences for d1ntob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ntob2 c.2.1.1 (B:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus}
lnaveaapltcsgittyravrkasldptktllvvgaggglgtmavqiakavsgatiigvd
vreeaveaakragadyvinasmqdplaeirriteskgvdavidlnysektlsvypkalak
qgkyvmvglfgadlhyhaplitlseiqfvgslvgnqsdflgimrlaeagk

SCOP Domain Coordinates for d1ntob2:

Click to download the PDB-style file with coordinates for d1ntob2.
(The format of our PDB-style files is described here.)

Timeline for d1ntob2: