Lineage for d1nl2a1 (1nl2 A:66-146)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1963115Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 1963116Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 1963117Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 1963219Protein Prothrombin [57448] (1 species)
  7. 1963220Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)
  8. 1963223Domain d1nl2a1: 1nl2 A:66-146 [91951]
    Other proteins in same PDB: d1nl2a2
    complexed with ca, cl, lps, nag

Details for d1nl2a1

PDB Entry: 1nl2 (more details), 2.3 Å

PDB Description: bovine prothrombin fragment 1 in complex with calcium and lysophosphotidylserine
PDB Compounds: (A:) Prothrombin

SCOPe Domain Sequences for d1nl2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nl2a1 g.14.1.1 (A:66-146) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgq

SCOPe Domain Coordinates for d1nl2a1:

Click to download the PDB-style file with coordinates for d1nl2a1.
(The format of our PDB-style files is described here.)

Timeline for d1nl2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nl2a2