Lineage for d1n9gf2 (1n9g F:161-349)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102559Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2102560Protein 2,4-dienoyl-CoA reductase [89517] (1 species)
  7. 2102561Species Yeast (Candida tropicalis) [TaxId:5482] [89518] (6 PDB entries)
  8. 2102571Domain d1n9gf2: 1n9g F:161-349 [91731]
    Other proteins in same PDB: d1n9ga1, d1n9gb1, d1n9gc1, d1n9gd1, d1n9ge1, d1n9gf1
    complexed with nap, so4

Details for d1n9gf2

PDB Entry: 1n9g (more details), 1.98 Å

PDB Description: mitochondrial 2-enoyl thioester reductase etr1p/etr2p heterodimer from candida tropicalis
PDB Compounds: (F:) 2,4-dienoyl-CoA reductase

SCOPe Domain Sequences for d1n9gf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9gf2 c.2.1.1 (F:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]}
ltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsavgkyasqigkllnfnsisv
irdrpnldevvaslkelgatqvitedqnnskefgptikewikqsggeaklalncvggkss
tgiarklnnnglmltyggmsfqpvtiptslyifknftsagfwvtellknnkelktstlnq
iiawyeegk

SCOPe Domain Coordinates for d1n9gf2:

Click to download the PDB-style file with coordinates for d1n9gf2.
(The format of our PDB-style files is described here.)

Timeline for d1n9gf2: