Lineage for d1n4pl_ (1n4p L:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335133Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2335598Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2335726Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2335727Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2335742Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
    Uniprot Q02293 22-418 P53610
  8. 2335831Domain d1n4pl_: 1n4p L: [91634]
    Other proteins in same PDB: d1n4pa_, d1n4pc_, d1n4pe_, d1n4pg_, d1n4pi_, d1n4pk_
    complexed with cl, ger, grg, zn

Details for d1n4pl_

PDB Entry: 1n4p (more details), 2.65 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with geranylgeranyl diphosphate
PDB Compounds: (L:) Geranylgeranyl transferase type-1 subunit beta

SCOPe Domain Sequences for d1n4pl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4pl_ a.102.4.3 (L:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy
slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd
dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai
syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq
ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp
dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt

SCOPe Domain Coordinates for d1n4pl_:

Click to download the PDB-style file with coordinates for d1n4pl_.
(The format of our PDB-style files is described here.)

Timeline for d1n4pl_: