![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
![]() | Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins) |
![]() | Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries) Uniprot Q02293 22-418 P53610 |
![]() | Domain d1n4pl_: 1n4p L: [91634] Other proteins in same PDB: d1n4pa_, d1n4pc_, d1n4pe_, d1n4pg_, d1n4pi_, d1n4pk_ complexed with cl, ger, grg, zn |
PDB Entry: 1n4p (more details), 2.65 Å
SCOPe Domain Sequences for d1n4pl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4pl_ a.102.4.3 (L:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]} ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
Timeline for d1n4pl_: