![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) ![]() |
![]() | Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins) |
![]() | Protein Protein farnesyltransferase alpha-subunit [48441] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries) Uniprot Q04631 55-369 |
![]() | Domain d1n4pc_: 1n4p C: [91625] Other proteins in same PDB: d1n4pb_, d1n4pd_, d1n4pf_, d1n4ph_, d1n4pj_, d1n4pl_ complexed with cl, ger, grg, zn |
PDB Entry: 1n4p (more details), 2.65 Å
SCOPe Domain Sequences for d1n4pc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n4pc_ a.118.6.1 (C:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]} flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke ywryigrslqskhs
Timeline for d1n4pc_: