SCOPe 2.01: Domain d1n43d_: 1n43 D:

Lineage for d1n43d_ (1n43 D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (118 PDB entries)

8. Domain d1n43d_: 1n43 D: [91614]
   complexed with btn; mutant

Details for d1n43d_

PDB Entry: 1n43, 1.89 Å

PDB Description: streptavidin mutant n23a with biotin at 1.89a

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1n43d_:

Sequence; same for both SEQRES and ATOM records:

>d1n43d_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwyaqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv

Timeline for d1n43d_:

• d1n43d_ first appeared in SCOP 1.67
  
• d1n43d_ appears in SCOP 1.75
  
• d1n43d_ appears in SCOPe 2.02
  
• d1n43d_ appears in the current release, SCOPe 2.08