SCOP 1.73: Domain d1mqja_: 1mqj A:

Lineage for d1mqja_ (1mqj A:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (35 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (4 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (53 PDB entries)

8. Domain d1mqja_: 1mqj A: [91399]
   complexed with hwd, zn

Details for d1mqja_

PDB Entry: 1mqj, 1.65 Å

PDB Description: crystal structure of the glur2 ligand binding core (s1s2j) in complex with willardiine at 1.65 angstroms resolution

PDB Compounds: (A:) Glutamate receptor 2

SCOP Domain Sequences for d1mqja_:

Sequence; same for both SEQRES and ATOM records:

>d1mqja_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

Timeline for d1mqja_:

• d1mqja_ first appeared in SCOP 1.67
  
• d1mqja_ appears in SCOP 1.71
  
• d1mqja_ appears in SCOP 1.75
  
• d1mqja_ appears in the current release, SCOPe 2.08